Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABM0236-500 | 7 days | 500 µg | $550.00 |
Select product before adding to cart
|
||
| ABM0236-1 | 7 days | 1 mg | $880.00 |
Product Overview | |
| Name | ESR1 Antibody |
|---|---|
| Description | |
| Estrogen Receptor Alpha, Mouse Anti Human | |
| Synonyms | |
| Estrogen Receptor Beta. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Each mg was lyophilized with 1xPBS, 0.4% SDS and 4mM DTT. | |
| Stability | |
| Store lyophilized ESR2 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. | |
| Purity | |
| Greater than 90% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| CGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGGHAPRVRELLL DALSPEQLVL TLLEAEPPHV LISRPSAPFTEASMMMSLTKLADKELVHMI SWAKKI. | |
| Solubility | |
| It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it on cell culture. | |
| Background | |
| Estrogen Receptor 2 also known as ESR2 takes part in mediating the biological effects of estrogen, influencing various physiological and pathological processes. ESR2 is found in different tissues including the brain, reproductive organs, bones, cardiovascular system, and immune cells and has distinct functions. ESR2 is involved in various biological processes by responding to estrogen which is an important hormone in regulating reproductive and metabolic functions. | |
| Precautions | |
| ESR1 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
