Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABM0335-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| ABM0335-20 | 7 days | 20 µg | $290.00 | |||
| ABM0335-100 | 7 days | 100 µg | $720.00 |
Product Overview | |
| Name | HMGB1 Antibody |
|---|---|
| Description | |
| High-Mobility Group Box 1, Mouse Anti Human | |
| Synonyms | |
| HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1. | |
| Introduction | |
| High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The HMG1 (1mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4. | |
| Stability | |
| Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH | |
| Solubility | |
| It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| References | |
| 1. Title :High-Mobility Group Box 1 Mediates Epithelial-to-Mesenchymal Transition in Pulmonary Fibrosis Involving Transforming Growth Factor-b1/Smad2/3 Signaling Publication :Department of Pharmacy, Sir Run Run Shaw Hospital, School of Medicine, Zhejiang University, Hangzhou, People’s Republic of China (L.-C.L.); The First Affiliated Hospital of Anhui Medical University, Hefei, People’s Republic of China (D.-L.L., J.G.); School of Pharmacy, Anhui Medical University, Hefei, People’s Republic of China (X.-T.M., W.-H.C., W.-C.Z., J.L.); and School of Pharmacy, Anhui University of Chinese Medicine, Hefei, People’s Republic of China (D.-L.L., L.X., P.Z.). Link : HMGB1 prospec publication | |
| Precautions | |
| HMGB1 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
