Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABM0480-500 | 7 days | 500 µg | $550.00 |
Select product before adding to cart
|
||
| ABM0480-1 | 7 days | 1 mg | $880.00 |
Product Overview | |
| Name | MOG Antibody |
|---|---|
| Description | |
| myelin oligodendrocyte glycoprotein, Mouse Antibody | |
| Synonyms | |
| Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137. | |
| Introduction | |
| Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2 µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 | |
| Stability | |
| Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| MOG Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
