Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABM0732-5 | 7 days | 5 µg | $100.00 |
Select product before adding to cart
|
||
| ABM0732-20 | 7 days | 20 µg | $260.00 | |||
| ABM0732-100 | 7 days | 100 µg | $720.00 |
Product Overview | |
| Name | REXO1 Antibody |
|---|---|
| Description | |
| RNA exonuclease 1 homolog, Mouse Anti Human | |
| Synonyms | |
| Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA. | |
| Introduction | |
| RORC is a DNA-binding transcription factor which belongs to the NR1 subfamily of nuclear hormone receptors. The specific functions of the RORC protein are not known; nevertheless, studies of a similar gene in mice have shown that the RORC gene may be vital for lymphoid organogenesis and may have an imperative regulatory role in thymopoiesis. Furthermore, studies in mice suggest that RORC may inhibit the expression of Fas ligand and IL2. RORC may be a possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. RORC is Crucial for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. RORC is also involved in lineage specification of uncommitted CD4(+) T helper cells into Th17 cells. In addition, RORCs regulate the expression of several components of the circadian clock. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 80.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEF MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAY SCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMS KKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLT YTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLA KAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRF EEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQS VCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMW ERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDF SHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLE LAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPI VVQAAFPPLYKELFSTETESPVGLSK. | |
| Precautions | |
| REXO1 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
