Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABP0020-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| ABP0020-20 | 7 days | 20 µg | $290.00 | |||
| ABP0020-100 | 7 days | 100 µg | $720.00 |
Product Overview | |
| Name | IFN a 2a Antibody |
|---|---|
| Description | |
| Interferon a 2a Polyclonal Rabbit Anti-Human Antibody | |
| Synonyms | |
| Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a. | |
| Introduction | |
| IFN-alpha is produced by macrophages and has antiviral activities. IFN stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized without additives. | |
| Stability | |
| Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| CDLPQTHSLGSRRTLMLLAQMR K ISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. N-terminal methionine has been completely removed enzymatically. | |
| Biological Activity | |
| The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Interferon-alpha-2a in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| References | |
| 1. Title :Gender specificity of altered human immune cytokine profiles in aging. Publication :Published online before print May 7, 2010, doi: 10.1096/fj.10-160911 September 2010 The FASEB Journal vol. 24 no. 9 3580-3589 Link: IFN a 2a prospec publication 2. Title: Differential involvement of 5-HT1A and 5-HT1B/1D receptor in human IFN a-induced immobility Publication: Arzneimittel-Forschung 60.3 (2009): 109-115. Link: IFN-Alpha 2a prospec publication | |
| Protein content | |
| Protein quantitation was carried out by two independent methods: 1. UV spectroscopy at 280 nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IFN-a 2a as a Reference Standard. | |
| Precautions | |
| IFN a 2a Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
