Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABP0031-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| ABP0031-20 | 7 days | 20 µg | $290.00 | |||
| ABP0031-100 | 7 days | 100 µg | $720.00 |
Product Overview | |
| Name | TGFB2 Antibody |
|---|---|
| Description | |
| Transforming Growth Factor-beta 2 Polyclonal Rabbit Anti Human Antibody | |
| Synonyms | |
| Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2. | |
| Introduction | |
| TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. | |
| Source | |
| Nicotiana benthamiana. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. | |
| Stability | |
| Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| HHHHHH ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS. | |
| Biological Activity | |
| The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H 2 O not less than 1 µg/40 µl, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| TGFB2 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
