Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CDA0079-1 | 7 days | 1 µg | $120.00 |
Select product before adding to cart
|
||
| CDA0079-5 | 7 days | 5 µg | $290.00 | |||
| CDA0079-50 | 7 days | 50 µg | $1,920.00 |
Product Overview | |
| Name | CD44 Human |
|---|---|
| Description | |
| CD44 Human Recombinant | |
| Accession (Primary) | P16070 |
| Synonyms | |
| cd-44. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Each mg was lyophilized with 1xPBS, 0.4% SDS and 4mM DTT. | |
| Stability | |
| Store lyophilized CD44 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| EETATQKEQWFGNRWHEGYRQTPREDSHSTTGTAAASAHTSHPMQG RTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSTTLQPTANP NTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRN DVTGGRRDPNHSEGSTTLLEGYTSHYPHTK | |
| Solubility | |
| It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it on cell culture. | |
| Background | |
| CD44 is a cell-surface glycoprotein which take part in migration, cell-cell interactions and cell adhesion. CD44 is a receptor of hyaluronic acid which interacts with other ligands such as collagens, osteopontin and matrix metalloproteinases. CD44 has various of functions such as lymphocyte activation, tumor metastasis, recirculation & homing and hematopoiesis. | |
| Precautions | |
| CD44 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P16070 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
