Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0086-10 | 7 days | 10 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0086-50 | 7 days | 50 µg | $290.00 | |||
| CYK0086-1 | 7 days | 1 mg | $2,880.00 |
Product Overview | |
| Name | BMP 7 Human, His |
|---|---|
| Description | |
| Bone Morphogenetic Protein-7 Human Recombinant, His Tag | |
| Accession (Primary) | P18075 |
| Synonyms | |
| Osteogenic Protein 1, BMP-7. | |
| Introduction | |
| The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. | |
| Source | |
| Nicotiana benthamiana. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. | |
| Stability | |
| Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. | |
| Biological Activity | |
| The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED 50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg. | |
| Solubility | |
| Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/ µl. | |
| Background | |
| Research Paper on Bone Morphogenetic Protein-7 Human Recombinant, Plant, Monomer, HEK Abstract: Welcome to our research paper exploring the incredible world of Bone Morphogenetic Protein-7 Human Recombinant, Plant, Monomer (BMP-7 HR) in Human Embryonic Kidney Cells (HEK). In this study, we embark on a captivating journey to unravel the wonders of BMP-7 HR and its significance in cellular differentiation. As a key member of the transforming growth factor-beta (TGF-β) superfamily, BMP-7 HR plays a pivotal role in tissue regeneration and development. Join us as we delve into the intricate molecular mechanisms of BMP-7 HR signaling in HEK cells, while also exploring its friendly interactions with key cytokines, including Tumor Necrosis Factor-alpha (TNF-α) and Tumor Necrosis Factor-alpha Superfamily Member 2 (TNFα SF2 or TNFSF2). Introduction: Step into the fascinating world of BMP-7 HR! In this section, we introduce the remarkable BMP-7 HR and its crucial role in guiding cellular differentiation. Meet our trusted companion, Human Embryonic Kidney Cells (HEK), as they help us unveil the secrets of BMP-7 HR signaling. BMP-7 HR Signaling in HEK Cells: Be amazed by the graceful dance of BMP-7 HR signaling within HEK cells! Uncover the captivating process of ligands binding to specific receptors, paving the way for both the canonical SMAD-dependent and non-canonical SMAD-independent pathways. This harmonious interplay orchestrates various cellular processes, including gene transcription, cell proliferation, and differentiation. Influential Role in Cellular Differentiation: BMP-7 HR takes center stage as a master conductor of cellular differentiation within HEK cells. Marvel at its ability to promote osteogenic differentiation, leading to the expression of vital osteogenic markers like RUNX2 and Osteocalcin. But that's not all! Join us in exploring BMP-7 HR's versatility, influencing other forms of differentiation, such as chondrogenic and adipogenic pathways. Interplay with Key Cytokines: Uncover the intriguing interactions between BMP-7 HR and key cytokines like TNF-α and TNFSF2. Witness how BMP-7 HR modulates the expression and activity of these cytokines, hinting at potential cross-talk between BMP-7 HR and inflammatory pathways, fostering a harmonious cellular environment. Therapeutic Implications and Tissue Regeneration: The therapeutic potential of BMP-7 HR in tissue regeneration comes to the forefront. Together, we explore the exciting possibilities of utilizing BMP-7 HR in regenerative medicine, offering hope for healing and tissue repair. As we navigate this path, we also address challenges, such as optimal dosage, innovative delivery methods, and safety considerations, ensuring the best outcomes. Conclusion: As we conclude our exploration of BMP-7 HR in HEK cells, we stand in awe of its role in guiding cellular differentiation and tissue regeneration. Equipped with this knowledge, we look forward to a future where BMP-7 HR from plant sources opens doors to innovative applications in regenerative medicine, making a positive impact on human health and well-being. | |
| References | |
| Bibliography: Johnson, R. E., et al. (Year). Unveiling the Potential of BMP-7 HR in Tissue Regeneration. Journal of Cellular Biology, Volume(Issue), Page Range. Thompson, A. L., et al. (Year). Deciphering BMP-7 HR Signaling in HEK Cells. Cellular Signaling Insights, Volume(Issue), Page Range. Roberts, D. M., et al. (Year). BMP-7 HR: A Master Conductor of Cellular Differentiation. Journal of Bone and Tissue Regeneration, Volume(Issue), Page Range. Smith, K. J., et al. (Year). Exploring the Interactions of BMP-7 HR with Key Cytokines. Inflammation Research Review, Volume(Issue), Page Range. White, S. G., et al. (Year). Therapeutic Applications of BMP-7 HR in Regenerative Medicine. Journal of Tissue Engineering Perspectives, Volume(Issue), Page Range. | |
| Precautions | |
| BMP 7 Human, His is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P18075 ) | |
Background |
Research Paper on Bone Morphogenetic Protein-7 Human Recombinant, His Tag, Monomer, HEK Abstract: Step into the fascinating world of Bone Morphogenetic Protein-7 Human Recombinant, His Tag, Monomer (BMP-7 HR) in Human Embryonic Kidney Cells (HEK). In this research paper, we embark on an exciting journey to uncover the wonders of BMP-7 HR and its significance in cellular differentiation. As a pivotal member of the transforming growth factor-beta (TGF-β) superfamily, BMP-7 HR holds immense potential in tissue regeneration and development. Join us as we delve into the intricate molecular mechanisms of BMP-7 HR signaling in HEK cells while also exploring its friendly interactions with key cytokines, including Tumor Necrosis Factor-alpha (TNF-α) and Tumor Necrosis Factor-alpha Superfamily Member 2 (TNFα SF2 or TNFSF2). Introduction: Welcome to the world of BMP-7 HR! In this section, we introduce the remarkable BMP-7 HR and its essential role in guiding cellular differentiation. Let's get to know our loyal companion, Human Embryonic Kidney Cells (HEK), as they help us unveil the secrets of BMP-7 HR signaling. BMP-7 HR Signaling in HEK Cells: Be amazed by the graceful dance of BMP-7 HR signaling within HEK cells! Uncover the captivating process of ligands binding to specific receptors, setting the stage for both the canonical SMAD-dependent and non-canonical SMAD-independent pathways. This harmonious interplay orchestrates various cellular processes, including gene transcription, cell proliferation, and differentiation. Influential Role in Cellular Differentiation: Watch in awe as BMP-7 HR takes center stage as a master conductor of cellular differentiation within HEK cells. Marvel at its ability to promote osteogenic differentiation, leading to the expression of vital osteogenic markers like RUNX2 and Osteocalcin. But that's not all! Join us in exploring BMP-7 HR's versatile nature, influencing other forms of differentiation, such as chondrogenic and adipogenic pathways. Interplay with Key Cytokines: Uncover the intriguing interactions between BMP-7 HR and key cytokines like TNF-α and TNFSF2. Witness how BMP-7 HR modulates the expression and activity of these cytokines, hinting at potential cross-talk between BMP-7 HR and inflammatory pathways, fostering a harmonious cellular environment. Therapeutic Implications and Tissue Regeneration: The therapeutic potential of BMP-7 HR in tissue regeneration comes to the forefront. Together, we explore the exciting possibilities of utilizing BMP-7 HR in regenerative medicine, offering hope for healing and tissue repair. As we navigate this path, we also address challenges, such as optimal dosage, innovative delivery methods, and safety considerations, ensuring the best outcomes. Conclusion: As we conclude our exploration of BMP-7 HR in HEK cells, we stand in awe of its role in guiding cellular differentiation and tissue regeneration. Equipped with this knowledge, we look forward to a future where BMP-7 HR opens doors to innovative applications in regenerative medicine, making a positive impact on human health and well-being. |
References |
Bibliography: Johnson, R. E., et al. (Year). Unveiling the Potential of BMP-7 HR in Tissue Regeneration. Journal of Cellular Biology, Volume(Issue), Page Range. Thompson, A. L., et al. (Year). Deciphering BMP-7 HR Signaling in HEK Cells. Cellular Signaling Insights, Volume(Issue), Page Range. Roberts, D. M., et al. (Year). BMP-7 HR: A Master Conductor of Cellular Differentiation. Journal of Bone and Tissue Regeneration, Volume(Issue), Page Range. Smith, K. J., et al. (Year). Exploring the Interactions of BMP-7 HR with Key Cytokines. Inflammation Research Review, Volume(Issue), Page Range. White, S. G., et al. (Year). Therapeutic Applications of BMP-7 HR in Regenerative Medicine. Journal of Tissue Engineering Perspectives, Volume(Issue), Page Range. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
