Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0098-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0098-10 | 7 days | 10 µg | $290.00 | |||
| CYK0098-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | BNP (27-102) Human |
|---|---|
| Description | |
| B-type Natriuretic Protein (27-102 a.a.) Human Recombinant | |
| Accession (Primary) | P16860 |
| Synonyms | |
| NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. | |
| Introduction | |
| Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The protein was lyophilized without additives. | |
| Stability | |
| Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by RP-HPLC. | |
| Amino acid sequence | |
| SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| BNP (27-102) Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P16860 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
