Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0185-20 | 7 days | 20 µg | $160.00 |
Select product before adding to cart
|
||
| CYK0185-100 | 7 days | 100 µg | $330.00 | |||
| CYK0185-1 | 7 days | 1 mg | $2,080.00 |
Product Overview | |
| Name | IFN a 1b Human |
|---|---|
| Description | |
| Interferon-Alpha 1b Human Recombinant | |
| Accession (Primary) | Q8WZ68 |
| Immunogen | |
| IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants. | |
| Synonyms | |
| Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a. | |
| Introduction | |
| IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase. | |
| Formulation | |
| Lyophilized from 0.2 µm sterile filtered solution in phosphate buffered saline, pH 7.4. | |
| Stability | |
| Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended. | |
| Purity | |
| Greater than 98.0% as determined by Analysis by SDS-PAGE. | |
| Solubility | |
| Reconstitute with H 2 0. Mix gently, wash the sides of the vial and wait 30-60 seconds before use. | |
| Applications | |
| ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/500 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a. Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,000. | |
| Type | |
| Polyclonal Rabbit Antibody. | |
| Purification Method | |
| Purified IgG prepared by affinity chromatography on protein G. | |
| Antigen Amino Acid Sequence | |
| CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE | |
| Precautions | |
| IFN a 1b Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q8WZ68 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
