Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0229-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0229-10 | 7 days | 10 µg | $290.00 | |||
| CYK0229-1 | 7 days | 1 mg | $5,600.00 |
Product Overview | |
| Name | IL 1 beta Human |
|---|---|
| Description | |
| Interleukin-1 beta Human Recombinant | |
| Accession (Primary) | P01584 |
| Synonyms | |
| Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. | |
| Introduction | |
| Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. | |
| Source | |
| HEK. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The IL-1 beta was lyophilized from 1mg/ml in 1xPBS. | |
| Stability | |
| Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as obsereved by SDS-PAGE. | |
| Amino acid sequence | |
| APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP VALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFES AQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS. | |
| Biological Activity | |
| The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA. | |
| Precautions | |
| IL 1 beta Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P01584 ) | |
References |
Title: Proinflammatory Cytokine IL-1b Stimulates IL-8 Synthesis in Mast Cells via a Leukotriene B4 Receptor 2-Linked Pathway, Contributing to Angiogenesis.Publication: Published online before print March 1, 2010, doi: 10.4049/ jimmunol.0901735 The Journal of Immunology April 1, 2010 vol. 184 no. 7 3946-3954.Link: IL 1 beta prospec publication Application: Level of IL-8 mRNA was dramatically enhanced by IL-1b,HMC-1 cells were stimulated with IL-1b. 2.Title:Contribution of IL-1 to resistance to Streptococcus pneumoniae infection . Publication: Int. Immunol. (2008) 20 (9): 1139-1146. doi: 10.1093/intimm/dxn071 First published online: July 1, 2008 Link: IL 1 beta Human prospec publication 3.Title: Hydrogen sulphide decreases IL-1b induced activation of fibroblast?like synoviocytes from patients with osteoarthritis Publications: journal of cellular and molecular medicine 19.1 (2015): 187-197 Link: Interleukin-1 beta prospec publication 4. Title: Riampin Augments Cytokine-Induced Nitric Oxide Production in Human Alveolar Epithelial Cells Publications: Antimicrobial agents and chemotherapy 50.1 (2006): 396-398 Link: Interleukin-1 beta Human prospec publication 5. Title: Adiponectin may contribute to synovitis and joint destruction in rheumatoid arthritis by stimulating vascular endothelial growth factor, matrix metalloproteinase-1, and matrix metalloproteinase-13 expression in fibroblast-like synoviocytes more than proinflammatory mediators Publication: Arthritis Res Ther 11.6 (2009): R161. Link: IL-1 beta prospec publication |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
