Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0230-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0230-10 | 7 days | 10 µg | $290.00 | |||
| CYK0230-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | IL 1 beta Human, HEK |
|---|---|
| Description | |
| Interleukin-1 beta Human Recombinant, HEK | |
| Accession (Primary) | P01584 |
| Synonyms | |
| Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. | |
| Introduction | |
| Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered clear solution. | |
| Formulation | |
| IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | |
| Precautions | |
| IL 1 beta Human, HEK is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P01584 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
