Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0278-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0278-10 | 7 days | 10 µg | $290.00 | |||
| CYK0278-1 | 7 days | 1 mg | $7,488.00 |
Product Overview | |
| Name | IL 19 Human |
|---|---|
| Description | |
| Interleukin-19 Human Recombinant | |
| Accession (Primary) | Q9UHD0 |
| Synonyms | |
| Interleukin-19, IL-19, Il19. | |
| Introduction | |
| IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a sterile filtered aqueous solution containing 5mM Na 3 PO 4 and 150mM NaCl, pH 7.5. | |
| Stability | |
| Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H 2 O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| IL 19 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q9UHD0 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
