Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0381-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0381-10 | 7 days | 10 µg | $290.00 | |||
| CYK0381-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | IL-17E Human, HEK |
|---|---|
| Description | |
| Interleukin-17E Human Recombinant, HEK | |
| Accession (Primary) | Q9H293 |
| Synonyms | |
| IL-25, IL-17E, IL17E, IL25, Interleukin-25. | |
| Introduction | |
| IL-25 also called IL-17E cytokine has a sequence similarity with IL17. IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesn’t induce allergic inflammation in vivo. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives. | |
| Stability | |
| Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS PPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRD LNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV CVRPRVMA. | |
| Biological Activity | |
| The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| IL-17E Human, HEK is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q9H293 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
