Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0567-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0567-20 | 7 days | 20 µg | $290.00 | |||
| CYK0567-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | TNFR Human |
|---|---|
| Description | |
| Tumor Necrosis Factor Receptor Human Recombinant | |
| Accession (Primary) | P19438 |
| Synonyms | |
| Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588. | |
| Introduction | |
| TNFR1 belongs to the TNF-receptor superfamily. TNFR1 is a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury. TNFR1 is capable of signaling both cell survival and apoptosis. TNFR1-induced apoptosis requires 2 sequential signaling complexes. TNFR1 is capable of activating NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNFR1 contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Human TNFR1 has a major region which controls cell surface expression. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women. Germline mutations of the extracellular domains of TNFR1 are linked to the autosomal dominant periodic fever syndrome. The impaired receptor clearance is believed to be a mechanism of the disease. Familial hibernian fever (FHF) is caused by defects in TNFRSF1A gene. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered clear solution. | |
| Formulation | |
| TNFR His Tag protein is supplied in 1xPBS, 50% glycerol. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQ DTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVE ISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCL NGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKK SLECTKLCLPQIEN. | |
| References | |
| Title: β-Catenin Signaling Pathway Is Crucial for Bone Morphogenetic Protein 2 to Induce New Bone Formation * Publication: First Published on November 3, 2006, doi: 10.1074/jbc.M602700200 January 5, 2007 The J ournal of Biological Chemistry, 282,526-533. Link: TNFR prospec publication | |
| Precautions | |
| TNFR Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P19438 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
