Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| CYK0605-1 | 7 days | 1 µg | $120.00 |
Select product before adding to cart
|
||
| CYK0605-5 | 7 days | 5 µg | $290.00 | |||
| CYK0605-50 | 7 days | 50 µg | $1,440.00 |
Product Overview | |
| Name | TPO Human, CHO |
|---|---|
| Description | |
| Thrombopoietin Human Recombinant, CHO | |
| Accession (Primary) | P40225 |
| Synonyms | |
| Megakaryocyte colony-stimulating factor, Myeloproliferative leukemia virus oncogene ligand, C-mpl ligand, ML, Megakaryocyte growth and development factor, MGDF, TPO, MKCSF, MPLLG, MGC163194, THPO. | |
| Introduction | |
| Thrombopoietin is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets. | |
| Source | |
| HEK. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The TPO protein was filtered (0.2 µm) and lyophilized from 0.74mg/ml in 1xPBS. | |
| Stability | |
| Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as obsereved by SDS-PAGE. | |
| Amino acid sequence | |
| SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPT PTSPLLNTSYTHSQNLSQEG | |
| Biological Activity | |
| The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED 50 is 1.15ng/ml. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA. | |
| Precautions | |
| TPO Human, CHO is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P40225 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
