Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List |
|---|
Product Overview | |
| Name | IL 4 Human, CHO |
|---|---|
| Description | |
| Interleukin-4 Human Recombinant, CHO | |
| Accession (Primary) | P05112 |
| Synonyms | |
| IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF. | |
| Introduction | |
| IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants. | |
| Source | |
| Chinese Hamster Ovarian Cells. | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| IL-6 is a sterile filtered (0.22 µm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by analysis by SDS-PAGE. | |
| Amino acid sequence | |
| VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM | |
| Biological Activity | |
| ED 50 < 1 ng/ml. The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line). | |
| Precautions | |
| IL 4 Human, CHO is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P05112 ) | |
References |
Title :A Network Modeling Approach to Analysis of the Th2 Memory Responses Underlying Human Atopic Disease Publication :doi: 10.4049/jimmunol.0804125 The Journal of Immunology May 15, 2009 vol. 182 no. 10 6011-6021 Link : http://www.jimmunol.org/content/182/10/6011.full |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
