Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0133-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0133-10 | 7 days | 10 µg | $290.00 | |||
| GRF0133-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | GHBP Human, Sf9 |
|---|---|
| Description | |
| Growth Hormone Binding Protein Human Recombinant, Sf9 | |
| Accession (Primary) | P10912 |
| Synonyms | |
| GHR, GHBP, GH receptor, Somatotropin receptor. | |
| Introduction | |
| GHBP is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3. | |
| Stability | |
| Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 98.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLK SPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVD QKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYK EVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP. | |
| Biological Activity | |
| Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO 3 pH 10, not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| GHBP Human, Sf9 is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P10912 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
