Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0158-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0158-10 | 7 days | 10 µg | $290.00 | |||
| GRF0158-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | HGFR Mouse |
|---|---|
| Description | |
| Hepatocyte Growth Factor Receptor Mouse Recombinant | |
| Accession (Primary) | P16056 |
| Immunogen | |
| IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants. | |
| Synonyms | |
| GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin. | |
| Introduction | |
| GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. | |
| Formulation | |
| Lyophilized from a sterile filtered (0.2 µm) solution containing phosphate buffered saline. | |
| Stability | |
| Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended. | |
| Purity | |
| Greater than 98%. | |
| Solubility | |
| Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely. | |
| Applications | |
| ELISA : to detect HGH by indirect ELISA, a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng/well of HGH. Western Blot : to detect HGH by WB analysis this antibody can be used in a dilution of 1/1,500. | |
| Type | |
| Polyclonal Rabbit Antibody. | |
| Purification Method | |
| Purified IgG prepared by affinity chromatography on protein G. | |
| Antigen Amino Acid Sequence | |
| FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF | |
| Precautions | |
| HGFR Mouse is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P16056 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
