Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0179-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0179-10 | 7 days | 10 µg | $290.00 | |||
| GRF0179-100 | 7 days | 100 µg | $1,920.00 |
Product Overview | |
| Name | IGFBP2 Mouse |
|---|---|
| Description | |
| Insulin Like Growth Factor Binding Protein-2 Mouse Recombinant | |
| Accession (Primary) | P47877 |
| Synonyms | |
| GH-dependant binding protein, IBP3, BP-53, IGFBP-3. | |
| Introduction | |
| IGFBP3 is a member of the IGFBP family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with IGFALS and either IGF I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a 0.2 µm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4. | |
| Stability | |
| Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK | |
| Biological Activity | |
| The ED 50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 × 10 3 IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| References | |
| Title :The role of IGFBP3 in the growth inhibitory actions of androgens in LNCaP human prostate cancer cells. Publication :Article first published online: 4 OCT 2007 DOI:10.1002/ijc.23100 Copyright © 2007 Wiley-Liss, Inc. Link : IGFBP3 prospec publication | |
| Precautions | |
| IGFBP2 Mouse is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P47877 ) | |
Background |
Insulin-like growth factor-binding protein 2 (IGFBP2) is a key regulator of insulin-like growth factor (IGF) signaling pathway, playing crucial roles in cell proliferation, differentiation, and survival. IGFBP2, a member of the IGFBP family, modulates the bioavailability and activity of IGFs by binding to them and regulating their interaction with cell surface receptors. In recent years, IGFBP2 has emerged as a promising target for research due to its involvement in various physiological processes and its implications in several diseases, including cancer, metabolic disorders, and neurodegenerative conditions. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
