Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0211-200 | 7 days | 200 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0211-1 | 7 days | 1 mg | $290.00 | |||
| GRF0211-5 | 7 days | 5 mg | $720.00 |
Product Overview | |
| Name | Leptin Protein |
|---|---|
| Description | |
| Leptin Human Recombinant | |
| Accession (Primary) | P41159 |
| Synonyms | |
| OB Protein, Obesity Protein, OBS, Obesity factor. | |
| Introduction | |
| A 16-kDa peptide hormone secreted from white adipocytes and implicated in the regulation of food intake and energy balance. Leptin provides the key afferent signal from fat cells in the feedback system that controls body fat stores. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3. | |
| Stability | |
| Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| A LPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC | |
| Biological Activity | |
| Biological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Pufferfish Leptin in sterile 0.4% NaHCO3 pH-9 not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Protein content | |
| Protein quantitation was carried out by UV spectroscopy at 280 nm using the absorbency value of 1.28 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). | |
| Precautions | |
| Leptin Protein is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P41159 ) | |
References |
1. Title :Leptin and Amylin Act in an Additive Manner to Activate Overlapping Signaling Pathways in Peripheral Tissues In vitro and ex vivo studies in humans. Publication :Published online before print September 24, 2010, doi: 10.2337/dc10-0518 Diabetes Care January 2011 vol. 34 no. 1 132-138 . Link : Leptin prospec publication 2. Title :The Mammalian Target of Rapamycin as Novel Central Regulator of Puberty Onset via Modulation of Hypothalamic Kiss1 System. Publication : Published online before print September 4, 2009, doi: 10.1210/en.2009-0096 Endocrinology November 1, 2009 vol. 150 no. 11 5016-5026 Link : Leptin Protein prospec publication 3. Title :p38 Mitogen-Activated Protein Kinase and Liver X Receptor-? Mediate the Leptin Effect on Sterol Regulatory Element Binding Protein-1c Expression in Hepatic Stellate Cells. Publication :Mol Med. 2012; 18(1): 10–18. Published online 2011 October 3. doi: 10.2119/molmed.2011.00243 Link : Leptin Human prospec publication 4. Title: PI3K integrates the effects of and leptin on large-conductance Ca2+-activated K+ channels in neuropeptide Y neurons of the hypothalamic arcuate nucleus Publication: American Journal of Physiology-Endocrinology and Metabolism 298.2 (2010): E193-E201. Link: OB Protein prospec publication |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
