Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0227-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0227-20 | 7 days | 20 µg | $290.00 | |||
| GRF0227-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | LGALS10 Human |
|---|---|
| Description | |
| Charcot-Leyden Crystal Protein Human Recombinant | |
| Accession (Primary) | Q05315 |
| Synonyms | |
| Galactoside-binding soluble lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, Placental protein 13, LGALS13, PLAC8, GAL13. | |
| Introduction | |
| Recombinant Galectin-13 is an E. coli expressed peptide, this protein is one of human placenta specific galectins, like all galectin family, it contains a carbohydrate recognition domain (CRD) as well. Increased blood concentration was found highly asscoaited with preeclampsia and HELLP syndrome in pregnant women. The molecular weight of galectin-13 is 16kDa. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered colorless solution. | |
| Formulation | |
| LGALS13 protein solution (0.5mg/ml) is formulated in 1xPBS buffer pH 7.4. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 90.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN | |
| Precautions | |
| LGALS10 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q05315 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
