Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0262-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0262-25 | 7 days | 25 µg | $290.00 | |||
| GRF0262-1 | 7 days | 1 mg | $5,760.00 |
Product Overview | |
| Name | MIF Human |
|---|---|
| Description | |
| Macrophage Migration Inhibitory Factor Human Recombinant | |
| Accession (Primary) | P14174 |
| Synonyms | |
| Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. | |
| Introduction | |
| The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered lyophilized powder. | |
| Formulation | |
| Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. | |
| Stability | |
| Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC ALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF ALEHHHHHH. | |
| Biological Activity | |
| Measured by its ability to bind rhCD74 in a functional ELISA. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| MIF Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P14174 ) | |
References |
Title: Macrophage migration inhibitory factor regulates proliferation of gastric cancer cells via the PI3K/Akt pathway Publication: WJG 15.44 (2009): 5541 . Link: MIF prospec publication |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
