Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0390-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0390-10 | 7 days | 10 µg | $290.00 | |||
| GRF0390-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | TGFB1 Mouse |
|---|---|
| Description | |
| Transforming Growth Factor-Beta 1 Mouse Recombinant | |
| Accession (Primary) | P04202 |
| Immunogen | |
| IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants. | |
| Synonyms | |
| Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2. | |
| Introduction | |
| TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a sterile filtered (0.2 µm) solution containing phosphate buffered saline. | |
| Stability | |
| Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended. | |
| Purity | |
| Greater than 98%. | |
| Solubility | |
| Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely. | |
| Applications | |
| Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000. | |
| Type | |
| Polyclonal Rabbit Antibody. | |
| Purification Method | |
| Purified IgG prepared by affinity chromatography on protein G. | |
| Antigen Amino Acid Sequence | |
| ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS | |
| Precautions | |
| TGFB1 Mouse is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P04202 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
