Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0399-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| GRF0399-10 | 7 days | 10 µg | $290.00 | |||
| GRF0399-1 | 7 days | 1 mg | $5,600.00 |
Product Overview | |
| Name | VEGF (121 a.a.) Human |
|---|---|
| Description | |
| Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant | |
| Accession (Primary) | P15692 |
| Synonyms | |
| Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609. | |
| Introduction | |
| Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation monocyte/ macrophagemigration, neurons, cancer cells, kidney epithelial cells ).VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesisand cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor. Elevated levels of this protein are linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. | |
| Source | |
| Sf9, Insect Cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The protein was lyophilized from a solution containing 50mM acetic acid. | |
| Stability | |
| Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR. | |
| Biological Activity | |
| Measured in a cell proliferation assay using primary HUVECs. The ED 50 for this effect is typically 2-10ng/ml. | |
| Solubility | |
| The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 µg/ml. | |
| Precautions | |
| VEGF (121 a.a.) Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P15692 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
