Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| GRF0461-2 | 7 days | 2 µg | $100.00 |
Select product before adding to cart
|
||
| GRF0461-10 | 7 days | 10 µg | $260.00 | |||
| GRF0461-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | Noggin Human, HEK |
|---|---|
| Description | |
| Noggin Human Recombinant, HEK | |
| Accession (Primary) | Q13253 |
| Synonyms | |
| Liver X receptor beta, LXRB, NER, NER-I. | |
| Introduction | |
| NR1H2 regulates the metabolism of cholesterol and bile acids. There are 2 subtypes of LXR, LXR-alpha & LXR-beta. NR1H2 is a ligand-dependent transcription factor that forms heterodimer with the retinoid X receptor. LXR- member of Nuclear Receptor Family is triggered by specific oxysterol derivatives of cholesterol. LXRB takes part in cholesterol, lipid, and carbohydrate metabolism. LXRB responds to increasing cholesterol levels via transactivation of genes involved in sterol transport (ABCA1, ABCG1, ABCG5, and ABCG8), cholesterol efflux and high-density lipoprotein (HDL) metabolism, and sterol catabolism (CYP7A1). NR1H2 is involved in regulating cellular lipid content through activation of SREBP-1c, which is the principal regulator of de novo lipogenesis. LXRB upregulates angiopoietin like protein 3 (Angpf13), part of the family of VEGFs that is also a main regulator of lipid metabolism. | |
| Source | |
| Nicotiana benthamiana. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a concentrated (1mg/ml) solution containing 20mM Tris Hcl pH-8 & 0.1% SDS. | |
| Stability | |
| Lyophilized LXRB although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution LXRB Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| HHHHHHSSGIEGRGRLIKHMTPGGSEAGSQGSGEGEGVQ LTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQ SRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRA GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNV QEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLV SLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized NR1H2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| Noggin Human, HEK is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q13253 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
