| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| ABP0036-30 | 7 days | 30 µg | $260.00 |
Select product before adding to cart
|
||
| ABP0036-60 | 7 days | 60 µg | $500.00 | |||
| ABP0036-250 | 7 days | 250 µg | $1,600.00 |
Product Overview | |
| Name | GST Polyclonal antibody |
|---|---|
| Description | |
| Glutathione-S-transferase Polyclonal Rabbit Antibody | |
| Synonyms | |
| Guanylate cyclase activator 2B, UGN, GCAP-II, GUCA2B. | |
| Introduction | |
| Prouroguanylin is a 112-amino-acid prohormone precursor of uroguanylin- mature biologically active 16-amino-acid peptide cleaved from its C-terminus. Guanylin binds to receptor-guanylate cyclases (CG-C) resulting in increased intracellular cGMP levels leading to CFTCR (Cystic Fibrosis Transmembrane Conductance Regulator) activation and subsequent rise in fluid and electrolyte secretion into the lumen. Prouroguanyline knock-out mice showed impaired renal excretion of external NaCl leading to elevated blood pressure independent of the level of diatary salt intake. Prouroguanylin is the predominant circulating molecular form found in circulation and in biological fluids. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered clear solution. | |
| Formulation | |
| 20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MKHHHHHHAS VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLP AVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL. | |
| Precautions | |
| GST Polyclonal antibody is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team