Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| HRM0032-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| HRM0032-10 | 7 days | 10 µg | $290.00 | |||
| HRM0032-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | FSH Human |
|---|---|
| Description | |
| Follicle Stimulating Hormone Human Recombinant | |
| Accession (Primary) | P01225 |
| Synonyms | |
| Follitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH. | |
| Introduction | |
| Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction: In women, in the ovary FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding protein by the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells. With the concomitant rise in inhibin B FSH levels then decline in the late follicular phase. This seems to be critical in selecting only the most advanced follicle to proceed to ovulation. At the end of the luteal phase, there is a slight rise in FSH that seems to be of importance to start the next ovulatory cycle. Like its partner, LH, FSH release at the pituitary gland is controlled by pulses of gonadotropin-releasing hormone (GnRH). Those pulses, in turn, are subject to the estrogen feed-back from the gonads. | |
| Source | |
| HEK293 | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The recombinant FSH was lyophilized from 0.2 µm filtered solution containing PBS, pH 7.4. | |
| Stability | |
| Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR SKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE. | |
| Biological Activity | |
| The ED 50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ-cm H 2 O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| FSH Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P01225 ) | |
Supporting scientific discovery through quality research products.
ADMEbio is committed to supporting scientific research with high-quality research products and laboratory solutions. We welcome publication submissions from researchers who have used our products in their studies. Your work helps advance scientific discovery and enables us to support the research community.
No publications are currently listed for this product.
Have you used this product in your research?
Submit your publication to help share your work with the scientific community.
Share Your Research
Submit your publications and allow other researchers to discover your work.
Advance Scientific Discovery
Help build a growing body of research that supports the scientific community.
Global Research Community
Your publications contribute to real-world research and innovation.
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
