Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| HRM0083-1 | 7 days | 1 mg | $120.00 |
Select product before adding to cart
|
||
| HRM0083-5 | 7 days | 5 mg | $290.00 | |||
| HRM0083-25 | 7 days | 25 mg | $800.00 |
Product Overview | |
| Name | Pramlintide |
|---|---|
| Description | |
| Pramlintide | |
| Introduction | |
| Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The protein was lyophilized with no additives. | |
| Stability | |
| Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid. | |
| Precautions | |
| Pramlintide is for research use only and not for use in diagnostic or therapeutic procedures. | |
Supporting scientific discovery through quality research products.
ADMEbio is committed to supporting scientific research with high-quality research products and laboratory solutions. We welcome publication submissions from researchers who have used our products in their studies. Your work helps advance scientific discovery and enables us to support the research community.
No publications are currently listed for this product.
Have you used this product in your research?
Submit your publication to help share your work with the scientific community.
Share Your Research
Submit your publications and allow other researchers to discover your work.
Advance Scientific Discovery
Help build a growing body of research that supports the scientific community.
Global Research Community
Your publications contribute to real-world research and innovation.
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
