Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| NTR0016-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| NTR0016-25 | 7 days | 25 µg | $290.00 | |||
| NTR0016-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | CNTF Mouse |
|---|---|
| Description | |
| Ciliary-Neurotrophic Factor Mouse Recombinant | |
| Accession (Primary) | P51642 |
| Synonyms | |
| HCNTF, CNTF, Ciliary Neurotrophic Factor. | |
| Introduction | |
| CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor. CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. | |
| Stability | |
| Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNI NLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRV HFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPA TVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESH YGAKDKQM. | |
| Biological Activity | |
| Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100 µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. | |
| Precautions | |
| CNTF Mouse is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P51642 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
