Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP0032-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| RCP0032-10 | 7 days | 10 µg | $290.00 | |||
| RCP0032-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | AHSG Human |
|---|---|
| Description | |
| Alpha-2-HS-Glycoprotein Human Recombinant | |
| Accession (Primary) | P02765 |
| Synonyms | |
| Alpha-2-HS-glycoprotein, Fetuin-A, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA, AHS, A2HS, HSGA, PRO2743. | |
| Introduction | |
| Fetuin is a liver-produced negative acute phase protein composed of two subunits, the A and B chains. Fetuin homologs have been identified in several species including rat, sheep, pig, rabbit, guinea pig, cattle, mouse and human. Multiple physiological roles for these homologs have been suggested, including ability to bind to hydroxyapatite crystals and to specifically inhibit the tyrosine kinase (TK) activity of the receptor (IR). Fetuin-A (alpha2-Heremans-Schmid glycoprotein; AHSG) is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. Sera from patients on long-term dialysis with low AHSG concentrations showed impaired ex-vivo capacity to inhibit CaxPO4 precipitation. Fetuin may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells, and mice lacking ASHG display growth plate defects, increased bone formation with age, and enhanced cytokine-dependent osteogenesis. | |
| Source | |
| HEK293 cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| AHSG was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.5. | |
| Stability | |
| Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIE IDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRK VCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTD CVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTP VVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSH PRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV VDHHHHHH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| AHSG Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P02765 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
