Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP0365-1 | 7 days | 1 µg | $260.00 |
Select product before adding to cart
|
||
| RCP0365-5 | 7 days | 5 µg | $600.00 | |||
| RCP0365-25 | 7 days | 25 µg | $1,920.00 |
Product Overview | |
| Name | CDCP1 Human |
|---|---|
| Description | |
| CUB Domain Containing Protein 1 Human Recombinant | |
| Accession (Primary) | Q9H5V8 |
| Synonyms | |
| Epithelial cadherin, E-cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324 antigen, CDH1, CDHE, UVO, ECAD, LCAM, Arc-1, CD324, Cadherin-E. | |
| Introduction | |
| E-cadherin (uvomorulin, cell-CAM120/80) is a calcium dependent cell adhesion molecule expressed predominately in epithelial tissues. It plays an important role in the growth and development of cells via the mechanisms of control of tissue architecture and the maintenance of tissue integrity. Numerous studies have demonstrated that reduction and/or loss of Ecadherin expression in carcinomas correlates positively with the potential of these tumors for invasion and metastasis. | |
| Source | |
| HEK cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The CDH1 protein was lyophilized from a 0.2 µm filtered solution in PBS, pH7.4. | |
| Stability | |
| Lyophilized E-Cadherin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CDH1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWL KVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVME GALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTG LDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVV ITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYIL HVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEP DTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPV ATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASAN WTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCR KAQPVEAGLQI HHHHHH . | |
| Solubility | |
| It is recommended to reconstitute the lyophilized CDH1 in sterile 18M-cm H 2 O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| CDCP1 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q9H5V8 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
