Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP0645-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP0645-20 | 7 days | 20 µg | $290.00 | |||
| RCP0645-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | DKK3 Human |
|---|---|
| Description | |
| Dickkopf-Related Protein 3 Human Recombinant | |
| Accession (Primary) | Q9UBP4 |
| Synonyms | |
| Dickkopf 3 homolog (Xenopus laevis), dickkopf-related protein 3, regulated in glioma, RIG, RIG-like 7-1, RIG-like 5-6, Dkk-3, REIC. | |
| Introduction | |
| Dickkopf-related protein 3 (DKK3) belongs to the DKK protein family including Dkk-1, 2, 3 and -4. DKK3 is a 350 amino acid secreted glycoprotein which is comprised of an N-terminal signal peptide and 2 conserved cysteine-rich domains that are separated by a 12 amino acid linker region. DKK3 is involved in embryonic development through its inhibition of the WNT signaling pathway. DKK3 gene expression is decreased in a variety of cancer cell lines and it may act as a tumor suppressor gene. | |
| Source | |
| HEK293 cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| DKK3 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.2. | |
| Stability | |
| Lyophilized DKK3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution DKK3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAA KASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVG DEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHC TKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLIT WELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVG SFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI VDHHHHHH . | |
| Solubility | |
| It is recommended to reconstitute the lyophilized DKK3 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| DKK3 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q9UBP4 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
