Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP0872-50 | 7 days | 50 µg | $1,200.00 |
Select product before adding to cart
|
||
| RCP0872-100 | 7 days | 100 µg | $1,800.00 | |||
| RCP0872-1 | 7 days | 1 mg | $6,400.00 |
Product Overview | |
| Name | Fra e 1.0101 |
|---|---|
| Description | |
| Allergen Fra e 1.0101 Recombinant | |
| Accession (Primary) | Q7XAV4 |
| Synonyms | |
| Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine. | |
| Introduction | |
| Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The CX3CL1 was lyophilized from a 0.2 µm filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl. | |
| Stability | |
| Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG. | |
| Biological Activity | |
| The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| References | |
| Title: Glial Cell Line-Derived Neurotrophic Factor and Neurturin Inhibit Neurite Outgrowth and Activate RhoA through GFR?2b, an Alternatively Spliced Isoform of GFR?2. Publication: The Journal of Neuroscience, 23 May 2007, 27(21): 5603-5614; doi: 10.1523/?JNEUROSCI.4552-06.2007. Link: Fractalkine prospec publication Applications: GFR?2 when activated by NTN, it inhibits neurite outgrowth induced by GFR?1a, GFR?2a, and GFR?2c isoforms. | |
| Precautions | |
| Fra e 1.0101 is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q7XAV4 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
