Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP0946-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP0946-20 | 7 days | 20 µg | $290.00 | |||
| RCP0946-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | GNGT1 Human |
|---|---|
| Description | |
| Guanine Nucleotide Binding Protein Gamma Transducing 1 Human Recombinant | |
| Accession (Primary) | P63211 |
| Synonyms | |
| LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E. | |
| Introduction | |
| GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives. | |
| Stability | |
| Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MGSSHHHHHH SSGLVPRGSHMMEGLVFSRLSPEYYD LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS TGPLGS HHHHHH . | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| GNGT1 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P63211 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
