Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP1557-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP1557-20 | 7 days | 20 µg | $290.00 | |||
| RCP1557-1 | 7 days | 1 mg | $5,760.00 |
Product Overview | |
| Name | OMP Human |
|---|---|
| Description | |
| Olfactory Marker Protein Human Recombinant | |
| Accession (Primary) | P47874 |
| Introduction | |
| Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection. | |
| Source | |
| E.Coli | |
| Physical Appearance | |
| Sterile filtered liquid formulation. | |
| Formulation | |
| The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. | |
| Stability | |
| Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Greater than 95% pure as determined by 12% PAGE (Coomassie staining). | |
| Amino acid sequence | |
| MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWP KDFTFVCPTEIIAFDKRVKDF Q EKGFNVIGVSIDSEQVHFAWK NTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLI DKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP AGWRKGDKGMKATHQGVAEYLKENSIKL. | |
| Purification Method | |
| Purified by proprietary chromatographic technique. | |
| Precautions | |
| OMP Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P47874 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
