Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP1687-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP1687-20 | 7 days | 20 µg | $290.00 | |||
| RCP1687-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | POMZP3 Human |
|---|---|
| Description | |
| POM121 And ZP3 Fusion Human Recombinant | |
| Accession (Primary) | Q6PJE2 |
| Synonyms | |
| Serum paraoxonase, arylesterase 1, EC 3.1.1.2, EC 3.1.8.1, PON 1, Serum aryldialkylphosphatase 1, A-esterase 1, Aromatic esterase 1, K-45, ESA, PON. | |
| Introduction | |
| Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs). | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| White lyophilized (freeze-dried) powder. | |
| Formulation | |
| lyophilized from 0.5 mg/mL in 20mM Tris buffer, 50 mM NaCl, pH 7.5 | |
| Stability | |
| Store at 4°C if entire vial will be used within 1-2 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 90% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGL AFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNA MYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLD PYLQSWEMYLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEK HANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILT EEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELEHHHHHH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized PON1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| POMZP3 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q6PJE2 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
