Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP1699-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP1699-20 | 7 days | 20 µg | $290.00 | |||
| RCP1699-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | PQBP1 Human |
|---|---|
| Description | |
| Polyglutamine Binding Protein 1 Human Recombinant | |
| Accession (Primary) | O60828 |
| Introduction | |
| Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The protein was lyophilized with no additives. | |
| Stability | |
| Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid. | |
| Precautions | |
| PQBP1 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( O60828 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
