Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP1714-1 | 7 days | 1 mg | $120.00 |
Select product before adding to cart
|
||
| RCP1714-10 | 7 days | 10 mg | $290.00 | |||
| RCP1714-100 | 7 days | 100 mg | $1,408.00 |
Product Overview | |
| Name | Protein Cys-A/G |
|---|---|
| Description | |
| Protein Cys-A/G Recombinant | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized white powder containing no additives. | |
| Stability | |
| Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. | |
| Purity | |
| >96% as determined by SDS-PAGE and RP-HPLC. | |
| Amino acid sequence | |
| LPKTD TYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE. | |
| Solubility | |
| Reconstitution with deionized water or PBS. | |
| Precautions | |
| Protein Cys-A/G is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
