Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2294-5 | 7 days | 5 µg | $120.00 |
Select product before adding to cart
|
||
| RCP2294-20 | 7 days | 20 µg | $290.00 | |||
| RCP2294-1 | 7 days | 1 mg | $4,320.00 |
Product Overview | |
| Name | SUMO1 Human His |
|---|---|
| Description | |
| Small Ubiquitin-Related Modifier 1 Human Recombinant, His Tag | |
| Accession (Primary) | P63165 |
| Synonyms | |
| Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191. | |
| Introduction | |
| Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. Unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. All SUMO proteins share the conserved ubiquitin domain and the C-terminal diglycine cleavage/attachment site. Human SUMO2, also known as Sentrin2 and SMT3B is synthesized as a 95 amino acid (aa), 11 kDa propeptide that contains a two aa C-terminal prosegment, and an 18 aa N-terminal protein interacting region (aa 33 -50). Following prosegment cleavage, the C-terminal glycine is enzymatically attached to a lysine on a target protein. Human SUMO2 shares 100% sequence identity to SUMO-2 from mouse. SUMO2 also has very high sequence homology to SUMO3 and SUMO4, 86 % and 85%, respectively. SUMO2 shares only 44% sequence identity to SUMO1. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0). | |
| Stability | |
| Can be stored at +4C for 1 week. For long term storage , below -20C. Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 90.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG. | |
| Precautions | |
| SUMO1 Human His is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P63165 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
