Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2354-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| RCP2354-10 | 7 days | 10 µg | $290.00 | |||
| RCP2354-1 | 7 days | 1 mg | $8,320.00 |
Product Overview | |
| Name | TFB2M Human |
|---|---|
| Description | |
| Transcription Factor B2, Mitochondrial Human Recombinant | |
| Accession (Primary) | Q9H5Q4 |
| Synonyms | |
| TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein. | |
| Introduction | |
| The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The Human TFF1 protein was lyophilized from a 0.2 µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl. | |
| Stability | |
| Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF. | |
| Biological Activity | |
| The ED 50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 µg/ml, corresponding to a specific activity of >100 IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| TFB2M Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q9H5Q4 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
