Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2398-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| RCP2398-10 | 7 days | 10 µg | $290.00 | |||
| RCP2398-100 | 7 days | 100 µg | $1,920.00 |
Product Overview | |
| Name | TNNI2 Human, His |
|---|---|
| Description | |
| Troponin I Type 2 Human Recombinant, His Tag | |
| Accession (Primary) | P48788 |
| Synonyms | |
| Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817. | |
| Introduction | |
| Troponin I (TnI), troponin T (TnT) and troponin C (TnC) form the troponin complex of the thin filaments of striated muscle. TnI is acts as the inhibitory subunit by blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains 3 genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TNNI3 gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in the TNNI3 gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered colorless liquid formulation. | |
| Formulation | |
| TNNI3 solution containing 6M Urea 50mM Tris PH 8. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by both SDS-PAGE. | |
| Amino acid sequence | |
| MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ IAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEE RYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKE SLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES. | |
| Precautions | |
| TNNI2 Human, His is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P48788 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
