Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2474-2 | 7 days | 2 µg | $120.00 |
Select product before adding to cart
|
||
| RCP2474-10 | 7 days | 10 µg | $290.00 | |||
| RCP2474-100 | 7 days | 100 µg | $1,600.00 |
Product Overview | |
| Name | TXN Mouse |
|---|---|
| Description | |
| Thioredoxin Mouse Recombinant | |
| Accession (Primary) | P10639 |
| Synonyms | |
| Thioredoxin-1, Trx-1, trxA, fipA, tsnC, b3781, JW5856. | |
| Introduction | |
| Thioredoxins are small disulphide-containing redox proteins (within the conserved Cys-Gly-Pro-Cys active site) that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. Thioredoxins are involved in the first unique step in DNA synthesis. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase.Its Molecular Weight is 11.9kDa. and the pI is 4.67. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Lyophilized Powder. | |
| Formulation | |
| Each mg of protein contains 20mM phosphate buffer pH 7.4. | |
| Stability | |
| TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA. | |
| Biological Activity | |
| TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13 µM bovine insulin containing 0.33mM DTT (pH 6.5). The specific activity was found to be 3IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized TRX in sterile 18MΩ-cm H2O. | |
| Precautions | |
| TXN Mouse is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P10639 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
