Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2629-2 | 7 days | 2 µg | $350.00 |
Select product before adding to cart
|
||
| RCP2629-5 | 7 days | 5 µg | $540.00 | |||
| RCP2629-10 | 7 days | 10 µg | $784.00 |
Product Overview | |
| Name | Bcl 6 Human |
|---|---|
| Description | |
| Bcl-6 Protein Human Recombinant | |
| Accession (Primary) | P41182 |
| Synonyms | |
| BMP4, ZYME, BMP2B, BMP2B1. | |
| Introduction | |
| The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. | |
| Source | |
| HEK. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The BMP-4 was lyophilized from 1.07mg/ml in 2xPBS+6% ethanol. | |
| Stability | |
| Lyophilized BMP4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95% as obsereved by SDS-PAGE. | |
| Amino acid sequence | |
| SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR. | |
| Biological Activity | |
| The specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 2.9ng/ml corresponding to a Specific Activity of 220,750.55IU/mg. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized BMP-4 in sterile 4mM HCl containing 0.1% endotoxin-free recombinant HSA. | |
| Precautions | |
| Bcl 6 Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P41182 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
