Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2653-10 | 7 days | 10 µg | $120.00 |
Select product before adding to cart
|
||
| RCP2653-50 | 7 days | 50 µg | $290.00 | |||
| RCP2653-1 | 7 days | 1 mg | $2,560.00 |
Product Overview | |
| Name | Hemopexin |
|---|---|
| Description | |
| Hemopexin Human | |
| Accession (Primary) | P02790 |
| Synonyms | |
| Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatopoeitin-A, Hepatocyte growth factor alpha chain. | |
| Introduction | |
| Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis. HGF is secreted as a single inactive polypeptide which is cleaved by serine proteases into a 69kDa Alpha chain and 34kDa Beta chain. A disulfide bond linking the alpha and beta chains produces the active, heterodimeric molecule. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered clear solution. | |
| Formulation | |
| HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN RCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKK EFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQP WSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWC FTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTES GKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQ PRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPEN FKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNC DMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIP WDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR. | |
| Precautions | |
| Hemopexin is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P02790 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
