Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2687-2 | 7 days | 2 µg | $350.00 |
Select product before adding to cart
|
||
| RCP2687-5 | 7 days | 5 µg | $540.00 | |||
| RCP2687-10 | 7 days | 10 µg | $784.00 |
Product Overview | |
| Name | SDC1, GST Human |
|---|---|
| Description | |
| Syndecan-1, GST-Tag Human Recombinant | |
| Accession (Primary) | P18827 |
| Synonyms | |
| SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4. | |
| Introduction | |
| Syndecan-4 is a type I integral membrane heparan sulfate proteoglycan (HSPG), which was originally isolated from cloned rat microvascular endothelial cells as an antithrombin-binding molecule, and is now known to be a member of the syndecan family. Syndecan-4 binds to basic fibroblast growth factor (bFGF), midkine, and tissue factor pathway inhibitor via its heparan sulfate chains, and is thought to be involved in various biologic functions such as signaling of bFGF, anticoagulation, and focal adhesion formation. A previous study demonstrated that syndecan-4 is expressed in various tissues, and its level of expression in the kidney is stronger than those of other syndecan family members. Thus, syndecan-4 is thought to play certain roles in maintaining renal function. Moreover, it has been reported that proteoglycans, especially sulfated proteoglycans, are involved in organogenesis of the kidney. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. | |
| Stability | |
| Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SDC4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGD LDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPK RISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized SDC4 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| SDC1, GST Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P18827 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
