Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2697-2 | 7 days | 2 µg | $350.00 |
Select product before adding to cart
|
||
| RCP2697-5 | 7 days | 5 µg | $540.00 | |||
| RCP2697-10 | 7 days | 10 µg | $784.00 |
Product Overview | |
| Name | SUMO2 Human, GST |
|---|---|
| Description | |
| Small Ubiquitin-Related Modifier 2 Human Recombinant, GST Tag | |
| Accession (Primary) | P61956 |
| Synonyms | |
| Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. | |
| Introduction | |
| Spleen Tyrosine Kinase (SYK) belongs to the family of non-receptor type Tyr protein kinases. The SYK protein is extensively expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events which mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. SYK is considered to be a modulator of epithelial cell growth and a likely tumor suppressor in human breast carcinomas. SYK is a positive effector of BCR-stimulated responses. SYK connects the B-cell antigen receptor (BCR) to the utilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway, when phosphorylated on Tyr-348 and Tyr-352. Therefore the differential phosphorylation of Syk can define the pathway by which BCR is coupled to the regulation of intracellular calcium ion (By similarity). SYK also phosphorylates USP25 and regulates its intracellular levels. | |
| Source | |
| HEK 293 cells. | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 85.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN. | |
| Precautions | |
| SUMO2 Human, GST is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P61956 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
