Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| RCP2702-1 | 7 days | 1 µg | $100.00 |
Select product before adding to cart
|
||
| RCP2702-5 | 7 days | 5 µg | $260.00 | |||
| RCP2702-50 | 7 days | 50 µg | $1,920.00 |
Product Overview | |
| Name | VAMP2 (1-94) Human |
|---|---|
| Description | |
| Synaptobrevin-2 (1-94 a.a) Human Recombinant | |
| Accession (Primary) | P63027 |
| Synonyms | |
| Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333. | |
| Introduction | |
| VCAM1 is a member of the Ig superfamily. It is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. VCAM-1 contains 6 or 7 immunoglobulin domains, and is expressed on both large and small vessels only after the endothelial cells are stimulated by cytokines. The protein has a number of functions including the regulation of leukocyte migration, leukocyte endothelial cell adhesion and signal transduction and may play a role in a number of inflammatory diseases (artherosclerosis and rheumatoid arthritis). | |
| Source | |
| Baculovirus sytem, insect cells. | |
| Physical Appearance | |
| Sterile Filtered colorless solution. | |
| Formulation | |
| The VCAM1 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. | |
| Purity | |
| Greater than 90% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENE HSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLM KKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVIS VNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTLIAMRMEDSGIYVCEG VNQIGKSRKEVELIVQEKPFTVEISPGPRIAAQIGDPVVLTCSVRGCETPSFSWRTQIDSPLNGQVT SEGTKSLLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIELSGPPVNGRPVTVSCKVP NVYPFDXLEIELLKGETMMKNKEFLEEEDKKSLETKSLEMTFIPTMEDTGKVLVCQAKLHIDEMEF EPKQRQSTQPLFVNVAPRDIAVWVSPSSIVEEGRSVNMTCSSYGLPAPKILWSRQLKNGDLQPLS ENTTLALISTKLEDSGIYVCEGINLAGKSRKEVELVIQVAPKDIQLTAFPSKSVKEGDTVIISCTCGNV PETWIILKKKAETGDTVLKSIDGAYTIRKAQLEDAGVYECESKNEVGSQLRSITLDVKGRENSKDYF SPE | |
| Precautions | |
| VAMP2 (1-94) Human is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( P63027 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
