Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List |
|---|
Product Overview | |
| Name | VCAM1 Rabbit |
|---|---|
| Description | |
| Vascular Cell Adhesion Molecule 1 Rabbit Recombinant | |
| Accession (Primary) | Q865F2 |
| Synonyms | |
| Vitamin D3 receptor, VDR, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR, NR1I1. | |
| Introduction | |
| Vitamin D receptors (VDRs) belong to the NR1I family, which also includes pregnane X (PXR) and constitutive androstane (CAR) receptors which form heterodimers with members of the retinoid X receptor family. VDR is expressed in the intestine, thyroid and kidney and has an imperative role in calcium homeostasis. VDRs inhibit expression of 1alpha-hydroxylase (the proximal activator of 1,25(OH)2D3 and induce expression of the 1,25(OH)2D3 inactivating enzyme CYP24. Additionally, VDR has recently been recognized as an additional bile acid receptor alongside FXR and may function to protect gut against the toxic and carcinogenic effects of these endobiotics. Hereditary mutations in the VDR gene leads to rickets, which is typified by muscle weakness, growth retardation, bone deformity and secondary hyperparathyroidism. The human gene encoding the VDR is localized to chromosome 12q12-q14. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| VDR protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. | |
| Stability | |
| Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. | |
| Purity | |
| Greater than 70.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYF QGEF MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGF HFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNR RHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEE EALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFR PPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITS SDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADL VSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRS NESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIK FQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQD RLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHS KQYRCLSFQPECSMKLTPLVLEVFGNEIS. | |
| Precautions | |
| VCAM1 Rabbit is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( Q865F2 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
