Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0121-100 | 7 days | 100 µg | $330.00 |
Select product before adding to cart
|
||
| VAG0121-500 | 7 days | 500 µg | $1,320.00 | |||
| VAG0121-1000 | 7 days | 1000 µg | $2,160.00 |
Product Overview | |
| Name | Dengue Epitope 13 |
|---|---|
| Description | |
| Dengue Multiple Epitopes 13 Recombinant | |
| Introduction | |
| Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus. | |
| Formulation | |
| PBS and 25mM K 2 CO 3 . | |
| Stability | |
| Dengue NS1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Protein is >85% pure as determined by 10% SDS-PAGE (coomassie staining). | |
| Amino acid sequence | |
| DSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIRSVTRLENLMW KQITPELNHILSENEVKLTIMTGDIKGIMQAGKRSLQPQPTELKYSWKTWGKAKMLSTESHNQTFLID GPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLKLREKQDVFCDSKLMSAAIKDNRAVHADMGYWIES ALNDTWKIEKASFIEVKSCHWPKSHTLWSNGVLESEMIIPKNFAGPVSQHNYRPGYHTQTAGPWHLGK LEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKE KEENLVNSLVTA | |
| Applications | |
| Immunoassay. | |
| Precautions | |
| Dengue Epitope 13 is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
